DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and Ca13

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001128465.1 Gene:Ca13 / 499566 RGDID:1560453 Length:262 Species:Rattus norvegicus


Alignment Length:270 Identity:74/270 - (27%)
Similarity:116/270 - (42%) Gaps:34/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SYNYDWDQGPHTWDTAC-----NNQSPINIDMNCVEINYFDTPLIWSHYNSIPLGIR-------- 132
            |:.||...||..|:...     :.||||.|...  |:.| |:.|       .||.|:        
  Rat     5 SWGYDEHNGPIHWNELFPIADGDQQSPIEIKTK--EVKY-DSSL-------RPLSIKYDPASAKI 59

  Fly   133 LENNGHTLILRAAFPERTPSIDGGDLLGRFDFREISFRWSWASSLGSEHTLDHHHSPLEMQCLHT 197
            :.|:||:..:.....|....:.||.|.|.:..|:....|..|...||||.:|......|:..:|.
  Rat    60 ISNSGHSFNVDFDDTEDKSVLRGGPLTGSYRLRQFHLHWGSADDHGSEHVVDGVRYAAELHVVHW 124

  Fly   198 DGDG----CDGCSSSQGVLMISYMFDLSEHNPFLDVLIQHLAAVEQAGQVVEVPPF-PLSYLMSP 257
            :.|.    .:....|.|:.::.....:.||||.|..:...|.::::.|:......| ||..|.|.
  Rat   125 NSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNFDPLCLLPSS 189

  Fly   258 FYDKFYSYNGSLTEPPCHRGAEWLIYPESLAISERQLNEFRQL----RDRRGSRIARNARPVQPI 318
            :  .:::|.||||.||......|::..:.::||.:||..||.|    .....:.:..|.||.||:
  Rat   190 W--DYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAAFLLSNHRPPQPL 252

  Fly   319 GDRMVYLNRY 328
            ..|.|..:.|
  Rat   253 KGRRVRASFY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 72/264 (27%)
Ca13NP_001128465.1 alpha_CA_I_II_III_XIII 2..261 CDD:239393 73/267 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339466
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.