DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and Ca12

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001074225.1 Gene:Ca12 / 363085 RGDID:1306612 Length:354 Species:Rattus norvegicus


Alignment Length:280 Identity:74/280 - (26%)
Similarity:122/280 - (43%) Gaps:36/280 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LRGSPESYNYDWDQGPHTWD---TACNN--QSPINIDMNCVEINYFDTPLIWSHYN-SIPLGIRL 133
            |.||  .:.|....|...|.   .:|..  ||||::..:.::.:....||.:..|| |:...:.|
  Rat    27 LNGS--KWTYIGPAGEKNWSKKYPSCGGLLQSPIDLHSDILQYDASLAPLQFQGYNVSVEKLLNL 89

  Fly   134 ENNGHTLILRAAFPERTPSIDGGDL----LGRFDFREISFRWSWAS---SLGSEHTLDHHHSPLE 191
            .|:||::.|..          ..|:    |....:|.......|.:   ..|||||:...|...|
  Rat    90 TNDGHSVRLNL----------NSDMYIQGLQPHQYRAEQLHLHWGNRNDPHGSEHTVSGKHFAAE 144

  Fly   192 MQCLHTDGDGCDGCSS----SQGVLMISYMFDLSEHNPFLDVLIQHLAAVEQAGQVVEVPPFPLS 252
            :..:|.:.|......|    |:|:.:::.:.::...||..|.:..||..|:..||.|.:|.|.:.
  Rat   145 LHIVHYNSDLYSDFGSASDKSEGLAVLAVLIEIGSVNPSYDKIFSHLQHVKYKGQQVLIPGFNIE 209

  Fly   253 YLMSPFYDKFYSYNGSLTEPPCHRGAEWLIYPESLAISERQLNE------FRQLRDRRGSRIARN 311
            .|:.....::|.|.||||.|||:....|.::...:.||:.||..      |..:.|.....:..|
  Rat   210 ELLPESPGEYYRYEGSLTTPPCYPTVLWTVFRNPVQISQEQLLALETALYFTHMDDPSPREMVNN 274

  Fly   312 ARPVQPIGDRMVYLNRYRTG 331
            .|.||...:|:||:: :|.|
  Rat   275 FRQVQKFDERLVYIS-FRQG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 68/265 (26%)
Ca12NP_001074225.1 alpha_CA 39..290 CDD:294017 68/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339446
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.