DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and CAH3

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster


Alignment Length:241 Identity:60/241 - (24%)
Similarity:109/241 - (45%) Gaps:15/241 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 QSPINIDMNCVE-INYFDTPLIWSHYNSIPLGI-RLENNGHTLILRAAFPERTPSIDGGDL-LGR 161
            ||||.|....:| |:..| ||.: |.:..|:|: |::|.|.:.::..:..::.|.|.||.| ...
  Fly     4 QSPIEISNRAIEHIDDVD-PLEY-HGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQDM 66

  Fly   162 FDFREISFRWSWASSLGSEHTLDHHHSPLEMQCLHTDG---DGCDGCSSSQGVLMISYMFDL--S 221
            :.|.::.|.||.....|.||||:.....:|...:|.:.   |..:..:...|:.::::....  .
  Fly    67 YVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLAVVAFFIQACGE 131

  Fly   222 EHNPFLDVLIQHLAAVEQAGQVVEVPPFPLSYL-MSPFYDKFYSYNGSLTEPPCHRGAEWLIYPE 285
            :..|....:.:.:..|::......:....||:: :......:|:|.||||..|......|:||..
  Fly   132 KDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTWIIYRT 196

  Fly   286 SLAISERQLNEFRQLRD---RRGSRIARNARPVQ-PIGDRMVYLNR 327
            .:.:|..|:..||.|:.   ....:|..|.|.:| |..|..::..|
  Fly   197 PIYVSRGQVQVFRNLQSCPKDESKKIVNNYREIQRPHKDPEIFFAR 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 59/237 (25%)
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 57/230 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.