DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and Ca9

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001101426.1 Gene:Ca9 / 313495 RGDID:1306426 Length:437 Species:Rattus norvegicus


Alignment Length:275 Identity:74/275 - (26%)
Similarity:125/275 - (45%) Gaps:30/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 NAGGDNCRRLRGSPESYNYDWDQGPHTW---DTACNN--QSPINIDMNCVEINYF-----DTPLI 120
            |..|.:.....|....::|.   |...|   ..||..  |||::|.:   |:..|     ...|:
  Rat   104 NRQGSHRDEKGGGHSLWSYG---GTLLWPQVSPACAGRFQSPVDIRL---ELTSFCRTLQPLELL 162

  Fly   121 WSHYNSIPLGIRLENNGHTLILRAAFPERTPSIDGGDLLGRFDFREISFRWSWASS--LGSEHTL 183
            .....|:| .:.|.|||||:.|  ..|.....:.|.   |: ::|.:.....|.:|  .|||||:
  Rat   163 GYELQSLP-ELSLCNNGHTVQL--TLPPGLKMVLGP---GQ-EYRALQLHLHWGTSDHPGSEHTV 220

  Fly   184 DHHHSPLEMQCLHTD---GDGCDGCSSSQGV-LMISYMFDLSEHNPFLDVLIQHLAAVEQAGQVV 244
            :.|..|.|:..:|..   .:..:......|: ::.:::.:..|.|...:.|:.||..:.:.|..:
  Rat   221 NGHRFPAEIHVVHLSTAFSELHEALGRPGGLAVLAAFLQESPEENSAYEQLLSHLEEIAEEGSKI 285

  Fly   245 EVPPFPLSYLMSPFYDKFYSYNGSLTEPPCHRGAEWLIYPESLAISERQLNEFR-QLRDRRGSRI 308
            |:|...:|.|:.....::|.|.||||.|||.:|..|.::.|::.:|.:||:... .|...|.||:
  Rat   286 EIPGLDVSALLPSDLSRYYRYEGSLTTPPCSQGVIWTVFNETVKLSAKQLHTLSVSLWGLRDSRL 350

  Fly   309 ARNARPVQPIGDRMV 323
            ..|.|..||:..|.:
  Rat   351 QLNFRATQPLNGRTI 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 71/259 (27%)
Ca9NP_001101426.1 alpha_CA 128..370 CDD:294017 69/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339486
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.