DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and Ca11

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_783639.1 Gene:Ca11 / 308588 RGDID:735155 Length:328 Species:Rattus norvegicus


Alignment Length:259 Identity:65/259 - (25%)
Similarity:109/259 - (42%) Gaps:23/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GPHTWD------TAC---NNQSPINIDMNCVEINYFDTPLIWSHYNSIPLGIRLENNGHTLILRA 144
            ||..|.      :.|   ..|||:::::..|..:.|..||..|.......|.......|...|.|
  Rat    48 GPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPA 112

  Fly   145 AFPERTPSIDGGDLLGRFDFREISFRWSWASSLGSEHTLDHHHSPLEMQCLHTDGDGCDGCSSS- 208
            :.|  ..::.||.||......|:...:......||||.::|.....|:|.:|.:.:.....|:: 
  Rat   113 SRP--VVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNLSAAS 175

  Fly   209 ---QGVLMISYMFDLS-EHNPFLDVLIQH--LAAVEQAGQVVEVPPFPLSYLMSPFYDKFYSYNG 267
               .|:.::|...::: ..||||..|:..  :..:........:....|. |:.|....|.:|.|
  Rat   176 RGPNGLAILSLFVNVAGSSNPFLSRLLNRDTITRISYKNDAYFLQDLSLE-LLFPESFGFITYQG 239

  Fly   268 SLTEPPCHRGAEWLIYPESLAISERQLNEFRQLRDRRGSRI----ARNARPVQPIGDRMVYLNR 327
            ||:.|||.....|::...:|.|:..|::..|.|.....|:|    :.|.||:||:..|.:..||
  Rat   240 SLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNGRPLQPLAHRALRGNR 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 63/255 (25%)
Ca11NP_783639.1 alpha_CARP_X_XI_like 48..304 CDD:239395 65/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339416
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.