DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and Ca8

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001009662.1 Gene:Ca8 / 297814 RGDID:1304709 Length:290 Species:Rattus norvegicus


Alignment Length:279 Identity:77/279 - (27%)
Similarity:127/279 - (45%) Gaps:53/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ESYNYDWDQGPHTW-----DTACNNQSPINIDMNCVEINYFDTPLIWSHYNSIPLGIRLE----- 134
            |...:.:::|.. |     |.....|||||  :|..|..| |..|         |.:||.     
  Rat    25 EGVEWGYEEGVE-WGLVFPDANGEYQSPIN--LNSREARY-DPSL---------LDVRLSPNYVV 76

  Fly   135 -------NNGHTL--ILRAAFPERTPSIDGGDL-LGR-FDFREISFRWSWASSLGSEHTLDHHHS 188
                   |:|||:  ||::     ...:.||.| .|: |:..|:.|.|...:..|||||::....
  Rat    77 CRDCEVTNDGHTIQVILKS-----KSVLSGGPLPQGQEFELYEVRFHWGRENQRGSEHTVNFKAF 136

  Fly   189 PLEMQCLHTD----GDGCDGCSSSQGVLMISYMFDLSEHNPFLDVLIQHLAAVEQAGQVVEVPPF 249
            |:|:..:|.:    |...:......|:::|:....:.:.:..|..:.:.|..::..|:...:|.|
  Rat   137 PMELHLIHWNSTLFGSIDEAVGKPHGIVIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCF 201

  Fly   250 -PLSYLMSPFYDKFYSYNGSLTEPPCHRGAEWLIYPESLAISERQLNEFRQLRDR-RGSRIAR-- 310
             |.:.|..|....::.|.||||.|||..|..|:::...|.||:.|:.|||:||.. :|:.:..  
  Rat   202 NPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGC 266

  Fly   311 ------NARPVQPIGDRMV 323
                  |.||.||:.||::
  Rat   267 DGILGDNFRPTQPLSDRVI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 76/277 (27%)
Ca8NP_001009662.1 alpha_CARP_VIII 35..289 CDD:239394 75/269 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339481
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.