DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and Car15

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001099371.1 Gene:Car15 / 288360 RGDID:1306018 Length:323 Species:Rattus norvegicus


Alignment Length:263 Identity:75/263 - (28%)
Similarity:119/263 - (45%) Gaps:36/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GPHTWD---TACN--NQSPINIDMNCVEINYFDTPLIWSHYNSIPLG-IRLENNGHTLILRA-AF 146
            ||..|.   .||.  .|||:|||:..|:.:|...|.|:..|:|.|.. ..|||:|||::||. :.
  Rat    34 GPAHWKELAPACGGPTQSPVNIDLRLVQRDYALKPFIFHGYDSAPQDPWILENDGHTVLLRVHSC 98

  Fly   147 PERTPSIDGGDL-LGRFDFREISFRWSWASSLGSEHTLDHHHSPLEMQCLHTDGD-GCDGCSSSQ 209
            .:..|:|.|..| ...:...::.|.|......||||::|..|..:||..:|.:.. ...|.:.||
  Rat    99 QQNCPAIRGAGLPSSEYRLLQLHFHWGSPGHKGSEHSVDEKHGSMEMHMVHMNTKYQSMGHARSQ 163

  Fly   210 --GVLMISYMF-DLSEHNPFLDVLIQHLAAVEQAGQVVEV-PPFPLSYLMSPFYD--KFYSYNGS 268
              |:.:::.:. :..:.|.....::..|..|...|..|.: ..|.|:.|:.....  ::|.|:||
  Rat   164 PDGLAILAVLLVEEDKDNTNFSAIVSGLKNVSSPGVSVNLTSTFALASLLPSALGLLRYYRYSGS 228

  Fly   269 LTEPPCHRGAEWLIYPESLAISERQLNEF-------------RQLRDRRGSRIARNARPVQPIGD 320
            ||.|.|.....|.::..::.|...|:.:|             |.|.|        |.||.||:|.
  Rat   229 LTTPGCEPAVLWTVFENTVPIGHAQVVQFQAVPQTGPPGLHPRPLTD--------NFRPQQPLGG 285

  Fly   321 RMV 323
            |.:
  Rat   286 RRI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 75/263 (29%)
Car15NP_001099371.1 alpha_CA_IV_XV_like 47..290 CDD:239391 70/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.