DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and Ptprz1

DIOPT Version :10

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_037212.2 Gene:Ptprz1 / 25613 RGDID:3455 Length:2316 Species:Rattus norvegicus


Alignment Length:219 Identity:66/219 - (30%)
Similarity:104/219 - (47%) Gaps:29/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CNN--QSPINIDMNCVEINY---------FDTPLIWSHYNSIPLGIRLENNGHTLILRAAFPERT 150
            ||:  |||||||.:..::|.         ::.|.:.:.:        :.|.|.|:.:...   ..
  Rat    56 CNSPKQSPINIDEDLTQVNVNLKKLKFQGWEKPSLENTF--------IHNTGKTVEINLT---ND 109

  Fly   151 PSIDGGDLLGRFDFREISFRWSW--ASSLGSEHTLDHHHSPLEMQCLHTDGD---GCDGCSSSQG 210
            ..:.||.....|...:::|.|..  .||.||||:|:....|||||....|.|   ..:.....:|
  Rat   110 YYLSGGLSEKVFKASKMTFHWGKCNVSSEGSEHSLEGQKFPLEMQIYCFDADRFSSFEETVKGKG 174

  Fly   211 VL-MISYMFDLS-EHNPFLDVLIQHLAAVEQAGQVVEVPPFPLSYLMSPFYDKFYSYNGSLTEPP 273
            .| .:|.:|::. |.|.....:|....:|.:.|:...:.||.|..|:....||:|.||||||.||
  Rat   175 RLRALSILFEIGVEENLDYKAIIDGTESVSRFGKQAALDPFILQNLLPNSTDKYYIYNGSLTSPP 239

  Fly   274 CHRGAEWLIYPESLAISERQLNEF 297
            |....||:::.::::|||.||..|
  Rat   240 CTDTVEWIVFKDTVSISESQLAVF 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 66/219 (30%)
Ptprz1NP_037212.2 alpha_CARP_receptor_like 45..298 CDD:239396 66/219 (30%)
fn3 313..401 CDD:394996
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 433..499
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 518..537
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 586..624
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 636..720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1141..1172
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1204..1228
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1401..1521
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1545..1622
PTP_DSP_cys 1718..1995 CDD:475123
R-PTP-Z-2 2078..2281 CDD:350507
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.