DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and CA14

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_036245.1 Gene:CA14 / 23632 HGNCID:1372 Length:337 Species:Homo sapiens


Alignment Length:277 Identity:77/277 - (27%)
Similarity:127/277 - (45%) Gaps:33/277 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ESYNYDWDQGPHTWDTA---CNN--QSPINIDMNCVEINYFDTPLIWSH-YN---SIPLGIRLEN 135
            :.:.|:...|...|..:   |.|  ||||:|..:.|..:. |.|.:..| |:   :.||.  |.|
Human    20 QHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDP-DLPALQPHGYDQPGTEPLD--LHN 81

  Fly   136 NGHTLILRAAFPERTPSIDGGDLLGRFDFREISFRWSWASSL-GSEHTLDHHHSPLEMQCLHTDG 199
            ||||:.|  :.|.   ::..|.|..::...::...|....|. ||||.::...:..|:..:|.|.
Human    82 NGHTVQL--SLPS---TLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDS 141

  Fly   200 DGCDGCSSS----QGVLMISYMFDLSE-HNPFLDVLIQHLAAVEQAGQVVEVPPFPLSYLMSPFY 259
            |..|..|.:    ||:.::..:.::.| .|...:.::.||..|....|...||||.|..|:....
Human   142 DSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQL 206

  Fly   260 DKFYSYNGSLTEPPCHRGAEWLIYPESLAISERQLNEFR----QLRDRRGSRIARNARPVQPIGD 320
            .:::.||||||.|||::...|.::.....||..||.:.:    ...:.....:.:|.|.:||:..
Human   207 GQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQ 271

  Fly   321 RMVYL------NRYRTG 331
            |||:.      :.|.||
Human   272 RMVFASFIQAGSSYTTG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 74/261 (28%)
CA14NP_036245.1 alpha_CA_XII_XIV 29..278 CDD:239400 73/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145736
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.