DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and Ptprg

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_599183.2 Gene:Ptprg / 171357 RGDID:620774 Length:1442 Species:Rattus norvegicus


Alignment Length:330 Identity:86/330 - (26%)
Similarity:141/330 - (42%) Gaps:63/330 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SNLLKFILAIGVALLVLFNVYTGFSLANRCDEGSNDGCANAGGDNCRRLRGSPESY-NYDWDQGP 90
            |::|.::    |....|...|.|....:|  :||:        ...||.:.|.:.| .|....||
  Rat    18 SSVLHYV----VCFPALTEGYVGTLQESR--QGSS--------VQIRRRKASGDPYWAYSGAYGP 68

  Fly    91 HTWDT---AC--NNQSPINI---------DMNCVEINYFD---TPLIWSHYNSIPLGIRLENNGH 138
            ..|.|   :|  ::||||:|         :...::::.||   :...|           ::|.|.
  Rat    69 EHWVTSSVSCGGSHQSPIDILDHHARVGEEYQELQLDGFDNESSNKTW-----------MKNTGK 122

  Fly   139 T--LILRAAFPERTPSIDGGDLLGRFDFREISFRWSWAS-SLGSEHTLDHHHSPLEMQCLHTDGD 200
            |  ::|:..:     .:.|..|.|||...::.|.|..:: |.||||:::....|:|||....:.|
  Rat   123 TVAILLKDDY-----FVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSVNGRRFPVEMQIFFYNPD 182

  Fly   201 GCD----GCSSSQGVLMISYMFDLS-EHNPFLDVLIQHLAAVEQAGQVVEVPPFPLSYLMSPFYD 260
            ..|    ..|.::.:..::..|.:| ..|..||.:|..|..|....:...:.||.|..|:.....
  Rat   183 DFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFVLRDLLPASLG 247

  Fly   261 KFYSYNGSLTEPPCHRGAEWLIYPESLAISERQLNEF-------RQLRDRRGSRIARNARPVQPI 318
            .:|.|.||||.|||....||:::...:.||..||..|       :|...:....:..|.||.|.:
  Rat   248 SYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVEYLRNNFRPQQAL 312

  Fly   319 GDRMV 323
            .||:|
  Rat   313 NDRVV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 74/275 (27%)
PtprgNP_599183.2 alpha_CARP_receptor_like 67..319 CDD:239396 72/267 (27%)
FN3 348..438 CDD:238020
R-PTPc-G-1 845..1118 CDD:350505
R-PTP-G-2 1202..1406 CDD:350508
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.