DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and si:ch211-173d10.4

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_021336146.1 Gene:si:ch211-173d10.4 / 108191769 ZFINID:ZDB-GENE-121214-331 Length:234 Species:Danio rerio


Alignment Length:203 Identity:54/203 - (26%)
Similarity:90/203 - (44%) Gaps:21/203 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 LENNGHTL--ILRAAFPERTPSIDGGDLLGRFDFREISFRWSW---ASSLGSEHTLDHHHSPLEM 192
            |.|||||:  .|:|.    ...:.||.|..::...:..|.|..   ....||||:|:.|..|:||
Zfish     4 LRNNGHTVECKLKAG----VVGVQGGGLKHKYTVLQFHFHWGGRDPRQQPGSEHSLNRHRWPVEM 64

  Fly   193 QCLHTDGDGCDGCSS--SQGVLMISYMFDLSEH--NPFLDVLIQHLAAVEQAGQVVEV-PPFPLS 252
            ..:....|..|..:|  ..|..::.:..|..|:  :...:..:::|..:.:.|..|.: ....|.
Zfish    65 HIVSRRTDLNDSAASRVPDGFAVMGFFIDGKENVTSQVWENFMEYLQKIPRKGDTVRITDDISLQ 129

  Fly   253 YLMSPF-YDKFYSYNGSLTEPPCHRGAEWLIYPESLAISERQLNEFRQLRDRRGSRIARNARPVQ 316
            .|::.. ..::|.|:||||.|||....:|.::.:.:.||..||..|:.:      ......||.|
Zfish   130 QLLTGVDLSRYYRYSGSLTTPPCDEAVQWTVFKDPIIISTDQLLRFQTV------SFGYVYRPQQ 188

  Fly   317 PIGDRMVY 324
            .:..|.||
Zfish   189 SLNKRTVY 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 54/203 (27%)
si:ch211-173d10.4XP_021336146.1 alpha_CA 1..196 CDD:320708 52/201 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.