DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and ca12

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_009296363.1 Gene:ca12 / 100537787 ZFINID:ZDB-GENE-080815-4 Length:505 Species:Danio rerio


Alignment Length:269 Identity:73/269 - (27%)
Similarity:121/269 - (44%) Gaps:27/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 YNYDWDQGPHTWDT---ACNN--QSPINIDMNCVEINYFDTPLIWSHYN-SIPLGIRLENNGHTL 140
            :.|:...|.|.|.|   .|..  ||||:...:.:..:....|:...:|| |....:.|.||||::
Zfish    22 WTYNGLDGEHDWPTNYPFCGGAFQSPIDFQTHLLRYDPNLPPIQVQNYNLSTSEQLTLGNNGHSV 86

  Fly   141 ILRAAFPERTPSIDGGDLLGRFDFREISFRWSWASSL-GSEHTLDHHHSPLEMQCLHTDGDGCDG 204
            .|  :.|..   :....|..|:...::.|.|..::.| |||||::......||..:|.:.|....
Zfish    87 QL--SLPSH---MYISSLPHRYSAAQLHFHWGSSNLLTGSEHTVNGKQFAGEMHVVHFNSDKYPN 146

  Fly   205 CSSS----QGVLMISYMFDLSEHNPFLDVLIQHLAAVEQAGQVVEVPPFPLSYLMSPFYDKFYSY 265
            .|.:    .|:.::....::.|.||..|.|.:.::.|:...|.::||.|.:..|:....|::|.|
Zfish   147 VSMAVDKHDGLAVLGVFIEIGEANPAFDKLFRFISGVKYRDQKIQVPAFNIRALLPDRLDQYYRY 211

  Fly   266 NGSLTEPPCHRGAEWLIYPESLAISERQL--------NEFRQLRDRRGSRIARNARPVQPIGDRM 322
            :||||.|||:....|.::.:.:.||.:|.        ..|.|  |.....:..|.|..| :.|..
Zfish   212 DGSLTTPPCYPSVLWTVFRKPVTISRKQFLALATALYASFAQ--DSPSMPLHENYRKSQ-LPDNR 273

  Fly   323 VYLNRYRTG 331
            |.|..:|.|
Zfish   274 VVLVSFREG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 70/261 (27%)
ca12XP_009296363.1 alpha_CA 29..279 CDD:294017 70/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.