DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and ca1

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_002939198.1 Gene:ca1 / 100496485 XenbaseID:XB-GENE-957160 Length:262 Species:Xenopus tropicalis


Alignment Length:271 Identity:67/271 - (24%)
Similarity:111/271 - (40%) Gaps:46/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SYNYDWDQGPHTWDTAC-----NNQSPINI---------DMNCVEINYFDTPLIWSHYNSIPLGI 131
            ::.||...||..|....     ::||||::         .:..:.|.|        :.:||.   
 Frog     5 NWGYDSHNGPDQWHKLYPIANGDSQSPIDVKSGEAKADESLKSLSIRY--------NSDSIK--- 58

  Fly   132 RLENNGHTLILRAAFPERTPSIDGGDLLGRFDFREISFRWSWASSLGSEHTLDHHHSPLEMQCLH 196
            .|.|.||:..:.|...|....:..|.|...:...:..|.|..::..|||||:|......|:..:|
 Frog    59 SLVNVGHSFQVLAEDKENPSVVAQGPLKATYRLNQFHFHWGASNDFGSEHTVDGKGYAAELHLVH 123

  Fly   197 TDGD----------GCDGCSSSQGVLMISYMFDLSEHNPFLDVLIQHLAAVEQAGQVVEVPPFPL 251
            .:.|          ..|||:      :::....:...:|.|..:::.|..:...|:......|..
 Frog   124 WNSDKYSSFAEASKNPDGCA------VVTVFIKVGSSHPGLQRVVEALELIAAKGKQAAFTNFDA 182

  Fly   252 SYLMSPFYDKFYSYNGSLTEPPCHRGAEWLIYPESLAISERQLNEFRQ-LRDRRGSR---IARNA 312
            |.|:....| :::|.||||.||......|:|:.|.::.|..|:|.||: |....|..   :..|.
 Frog   183 STLLPASMD-YWTYQGSLTHPPLLECVTWIIFKEPISASSEQINLFRRILSSAEGEEACPVLANH 246

  Fly   313 RPVQPIGDRMV 323
            ||.||:..|.|
 Frog   247 RPTQPLKGREV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 67/270 (25%)
ca1XP_002939198.1 alpha_CA 2..261 CDD:381753 67/271 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.