DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH15 and ca14

DIOPT Version :9

Sequence 1:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001103521.1 Gene:ca14 / 100126213 XenbaseID:XB-GENE-855636 Length:343 Species:Xenopus tropicalis


Alignment Length:269 Identity:73/269 - (27%)
Similarity:117/269 - (43%) Gaps:27/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LRGSPESYNYDWDQGPHTW-----DTACNNQSPINIDMNCVEINYFDTPLIWSHYNSIP--LGIR 132
            :|||  .:.|....|...|     |.....||||||..:.:..:....|:....||: |  ....
 Frog    16 VRGS--EWTYAGHHGQENWPVTYPDCGGTAQSPINIQTSNISYDESLPPIEPEGYNT-PGNQPFT 77

  Fly   133 LENNGHTLILRAAFPERTPSIDGGDLLGRFDFREISFRW-SWASSLGSEHTLDHHHSPLEMQCLH 196
            |.||||::.|  :.|.   |:....|...|...::...| |.|...||||.||....|.|:..:|
 Frog    78 LTNNGHSVEL--SLPS---SMTLRGLPNTFKAAQLHLHWGSPAKQAGSEHRLDGEEFPAELHIVH 137

  Fly   197 TDGDGCDGCSSSQ----GVLMISYMFDL-SEHNPFLDVLIQHLAAVEQAGQVVEVPPFPLSYLMS 256
            .:.|.....|.::    |:.::...|:: :..||....::.||..:....|.|.||.|.:.:|:.
 Frog   138 YNSDKYADISEAKNKPDGLAVLGVFFEIGATDNPAYANILHHLDNIRYKDQTVSVPSFNVRHLLP 202

  Fly   257 PFYDKFYSYNGSLTEPPCHRGAEWLIYPESLAISERQLNEFR-QLRDRRGSRI-----ARNARPV 315
            ...::::.|.||||.|||::...|.::...:.||..||.:.: .|.....:.:     ..|.|..
 Frog   203 ENLEEYFRYQGSLTTPPCYQSVLWTVFYHPVEISRSQLEKLQTTLYSTTATEVPPEVLGNNVREA 267

  Fly   316 QPIGDRMVY 324
            |.:..|.||
 Frog   268 QLLNSRTVY 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 70/262 (27%)
ca14NP_001103521.1 alpha_CA 28..279 CDD:294017 69/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.