DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otp and otpa

DIOPT Version :9

Sequence 1:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001122175.1 Gene:otpa / 560759 ZFINID:ZDB-GENE-070216-1 Length:332 Species:Danio rerio


Alignment Length:354 Identity:144/354 - (40%)
Similarity:166/354 - (46%) Gaps:99/354 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GGGVARLHISGGLCDNSNALNGGN---GSSGNGNGNNNNG---NGNNNNSMQQQDQH------LD 112
            |||...:| .|.|...|:|:.|..   |...|..|:|..|   |..:....|||.|:      ..
Zfish    47 GGGTDPVH-PGDLAPVSDAVEGATLLPGDDINSAGSNPPGVAVNSKDQEKQQQQQQNPTQSSSQQ 110

  Fly   113 KNKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKKT 177
            ..|||||||||||||||||||.|:||||||||||||:|:||||||||||||||||||||||||||
Zfish   111 SQKQKRHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT 175

  Fly   178 TNVFRTPGALLPS-HGLPPF-GANITNIAMGDGLCGTGMFGGD-RWSVGVNPMTAGFGQLNQSSP 239
            |||||.||.|||: ||||.| .|.....||||.||  .....| ||:....|   |..|| |..|
Zfish   176 TNVFRAPGTLLPTHHGLPQFPSAAAAAAAMGDSLC--SFHANDTRWAAAGMP---GVSQL-QLPP 234

  Fly   240 LSSSLNSGLNSGINMGSALGAGSYQHYGLNALGDSMMYQHSVGGVSCGPSGSPSATTPPNMNSCS 304
                                          |||.......|:...|.|      |..|||..|.|
Zfish   235 ------------------------------ALGRQQAMAQSLSQCSLG------AGPPPNSMSLS 263

  Fly   305 SVTPPPLSAQPNSSQNELNGEPMPLHQQQQQQTHQHQQQQTHQHHP----MAPPT---PTQQQQQ 362
            :::.              ||..:                |:|.:.|    |.|.:   ||.....
Zfish   264 NMSS--------------NGSGL----------------QSHLYQPTFPGMVPASLSGPTNVTGS 298

  Fly   363 LPQSMQSP-SDGANDTLHSIAALRRRASE 390
             ||...|| :|....|  |||:|||:|.|
Zfish   299 -PQLCSSPDTDVWRGT--SIASLRRKALE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otpNP_001286654.1 Homeobox 119..167 CDD:278475 43/47 (91%)
otpaNP_001122175.1 Homeobox 117..165 CDD:278475 43/47 (91%)
OAR 309..326 CDD:281777 9/18 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5919
eggNOG 1 0.900 - - E33208_3BA7E
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I4009
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1243020at2759
OrthoFinder 1 1.000 - - FOG0007109
OrthoInspector 1 1.000 - - otm25807
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46770
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4709
SonicParanoid 1 1.000 - - X5198
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.960

Return to query results.
Submit another query.