DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otp and OTX2

DIOPT Version :9

Sequence 1:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001257454.1 Gene:OTX2 / 5015 HGNCID:8522 Length:297 Species:Homo sapiens


Alignment Length:225 Identity:73/225 - (32%)
Similarity:105/225 - (46%) Gaps:45/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 KQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKR----- 174
            ||:|.||.||.|||:.||..|:||.|||||||||:|::|.|.||||||||:|||||.:::     
Human    45 KQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQ 109

  Fly   175 ----------KKTTNVFRTPGALLPSHG--LPPFGANITNIAMGDGLCGTGMFGGDRWSVG---- 223
                      ||.|:..|...:...:.|  .||...::..||........       ||..    
Human   110 NGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSI-------WSPASISP 167

  Fly   224 -VNPMTAGFGQLNQSSPLSSSLNSGLNSGINMGSALGAGSYQHYGLNALGD---SMMYQHSVGGV 284
             .:|::.....:.:|.|::.:..||.:.|.       |||..::|....|.   .|.:|....|.
Human   168 LSDPLSTSSSCMQRSYPMTYTQASGYSQGY-------AGSTSYFGGMDCGSYLTPMHHQLPGPGA 225

  Fly   285 SCGPSGSPSATTPPNMNSCSSVTPPPLSAQ 314
            :..|.|:.:.|:..|.      :|..||.|
Human   226 TLSPMGTNAVTSHLNQ------SPASLSTQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otpNP_001286654.1 Homeobox 119..167 CDD:278475 32/47 (68%)
OTX2NP_001257454.1 Homeobox 50..102 CDD:395001 37/51 (73%)
TF_Otx 163..242 CDD:397546 18/91 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I5000
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.