DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otp and CG9876

DIOPT Version :9

Sequence 1:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster


Alignment Length:237 Identity:67/237 - (28%)
Similarity:92/237 - (38%) Gaps:96/237 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LPVGPNLADLGGGAGGGG----SSGGVPVGGGVARLHISGGLCDNSNALNGGNGSSGNGNGNNNN 95
            :.:..|....|.|.||..    .||.:|.|||    |.|                          
  Fly    80 MELSSNFGPTGAGCGGADRPAPCSGNLPAGGG----HHS-------------------------- 114

  Fly    96 GNGNNNNSMQQQDQHLDKNKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRV 160
                              .|.:|:||.|:.|||..||:.|.:|||||.|:|||:|.::.|:|:||
  Fly   115 ------------------RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARV 161

  Fly   161 QVWFQNRRAKWKKRKKTT---NVFRTPGALLPS---------------HGLPP---------FG- 197
            ||||||||||:::.:::.   .:..|...|:|:               |..||         || 
  Fly   162 QVWFQNRRAKFRRNERSVGSRTLLDTAPQLVPAPISNNMHKYANMPHPHPQPPPPPGAYALNFGP 226

  Fly   198 ------ANITNI--------AMGDGLCGTGMFGGDRWSVGVN 225
                  .|.||.        |.|.|:|  ..||...:.|..|
  Fly   227 LELRSCQNYTNCYGGFGSSGASGSGVC--SFFGATNYCVAAN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otpNP_001286654.1 Homeobox 119..167 CDD:278475 28/47 (60%)
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450895
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.