DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otp and Poxn

DIOPT Version :9

Sequence 1:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster


Alignment Length:226 Identity:53/226 - (23%)
Similarity:74/226 - (32%) Gaps:66/226 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 TGMFGGDRWSVGVNPMTAGFGQLNQ-------SSPLSSSLNSGL-NSGI---NMGSALGAGSYQH 265
            :|||.   |.:.        .||.|       |.|..||:|..| |||:   .|.|:      |.
  Fly    97 SGMFA---WEIR--------EQLQQQRVCDPSSVPSISSINRILRNSGLWTDEMTSS------QQ 144

  Fly   266 YGLNALGDSMMYQHSVGGVSCGPSGSPSATTPPNMNSCSSVTPPPLSAQPN------------SS 318
            ....|...:....|..|.   |||.......||   ...:|.||..:|.|:            :|
  Fly   145 NAAAAAAAAAAAAHQAGS---GPSNGYGGQAPP---PPVTVAPPTPAATPSIARYAKPPALMMNS 203

  Fly   319 QNELNGEPMPLHQQQQQQTHQH-----------QQQQTHQHHPMAPPTPTQQQQQLPQSMQSPSD 372
            ..|:..:|.|.........|.|           .....|:|....|......|..: |:..:.|.
  Fly   204 AGEMPIKPAPKMPPSMGHGHSHGLNPNVSGLDLSYSALHKHWLWNPSLLYYTQAHI-QAQAAASG 267

  Fly   373 G-----ANDTL-HSIAALRRRASELNAIPSY 397
            |     |...| |::||  ..||..:|:..:
  Fly   268 GQFLPYAGGYLPHAMAA--AAASSTSALGGF 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otpNP_001286654.1 Homeobox 119..167 CDD:278475
PoxnNP_001261016.1 HTH 5..133 CDD:304362 14/46 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450954
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.