DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otp and prd

DIOPT Version :9

Sequence 1:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster


Alignment Length:397 Identity:107/397 - (26%)
Similarity:156/397 - (39%) Gaps:126/397 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ISGGLCDNS--------------------NALNGGNGS-SGNGN------GNNNNGNGNNNNSMQ 105
            |..|:||.|                    |.::..:|| :|:|.      |::.:| |::||...
  Fly   130 IREGVCDRSTAPSVSAISRLVRGRDAPLDNDMSSASGSPAGDGTKASSSCGSDVSG-GHHNNGKP 193

  Fly   106 QQDQHLD---------KNKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQ 161
            ..:...|         |.||:|.||.|:.:||:||||.|.:|.||||:.|||:|.|..|||:|:|
  Fly   194 SDEDISDCESEPGIALKRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQ 258

  Fly   162 VWFQNRRAKWKKRKKTTNVFRTPGALLPSHGLP-PFGANITNIAMGDGLCGTGMFGGDRWSVGVN 225
            |||.||||  :.||:.|:|         |.|.| ...|:::::|                     
  Fly   259 VWFSNRRA--RLRKQHTSV---------SGGAPGGAAASVSHVA--------------------- 291

  Fly   226 PMTAGFGQLNQSSPLSSSLNSGLNSGINMGS-ALGAGSYQHYGLNALGDSMMYQHSVGGVSCGPS 289
                          .||||.|.::|..:|.. |:..||        |..:.:||..........:
  Fly   292 --------------ASSSLPSVVSSVPSMAPLAMMPGS--------LDPATVYQQQYDFYGSHAN 334

  Fly   290 GSPSATTP---PNMNSCSSVTPPPLSAQPNSSQNEL-------NGEPMPL------HQQQQQQTH 338
            .|.||..|   .|::...:.|||......|.|.|..       ||...|.      ..:.|..:.
  Fly   335 ISVSAAAPMASSNLSPGITTTPPHHHQFYNPSANTASYIMPGENGNTTPTGNIIVSSYETQLGSV 399

  Fly   339 QHQQQQTHQHHP--------------MAPPTPTQQQQQLPQSMQSPSDGAN---DTLHSIAALRR 386
            ...:.:|||..|              ..||||......:..:..:.|.|||   |...|:|....
  Fly   400 YGTETETHQTMPRNESPNESVSSAFGQLPPTPNSLSAVVSGAGVTSSSGANSGADPSQSLANASA 464

  Fly   387 RASELNA 393
            .:.||:|
  Fly   465 GSEELSA 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otpNP_001286654.1 Homeobox 119..167 CDD:278475 28/47 (60%)
prdNP_723721.1 PAX 27..154 CDD:238076 5/23 (22%)
Homeobox 217..269 CDD:278475 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450945
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.