DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otp and CG32532

DIOPT Version :9

Sequence 1:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster


Alignment Length:216 Identity:66/216 - (30%)
Similarity:92/216 - (42%) Gaps:49/216 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GNNNNSMQQQDQHLDKN------KQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLT 156
            |:..:|:.|...|....      .::||||.||..||.|||..|:|:|||||:.|||:|....|.
  Fly   486 GSGLSSLSQHAGHTPTTASCPTPARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLN 550

  Fly   157 ESRVQVWFQNRRAKWKKRKKTTNVFRTPGALLPSHGLPPFGANITNIAMGDGL------------ 209
            |:|:||||||||||::|::|.......|..:...:|:.   .||...::..|.            
  Fly   551 EARIQVWFQNRRAKYRKQEKQLQKALAPSVIPSCNGMM---RNIQGYSVSRGYQPYPHHNTMNRY 612

  Fly   210 ------CGTGMFGG-----------DRWSVGVNPMTAGFGQLNQSSPLSSSLNSGLNSGINMGSA 257
                  .|...:.|           :..||||.  ....|:.:..||.....|..|       ||
  Fly   613 PQDLFQMGASSYPGMTQPFSMAHSTNMGSVGVR--QDSMGEFHGMSPEDEWYNKSL-------SA 668

  Fly   258 LGAGSYQHYGLNALGDSMMYQ 278
            |...|..|..|:|  ..:.||
  Fly   669 LRMNSSHHPNLSA--PMLQYQ 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otpNP_001286654.1 Homeobox 119..167 CDD:278475 29/47 (62%)
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450860
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.