DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otp and rx3

DIOPT Version :10

Sequence 1:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_571302.1 Gene:rx3 / 30474 ZFINID:ZDB-GENE-990415-238 Length:292 Species:Danio rerio


Alignment Length:186 Identity:68/186 - (36%)
Similarity:99/186 - (53%) Gaps:36/186 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 DQHLDKNKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWK 172
            |....|.|.:|:||.||..||:||||.|.|:||||::.|||:|:::.|.|.|||||||||||||:
Zfish    98 DDENPKKKHRRNRTTFTTFQLHELERAFEKSHYPDVYSREELALKVNLPEVRVQVWFQNRRAKWR 162

  Fly   173 KRKK--TTNVFRTPGALLPSHGLPPFGANITNIAMGDGLCGTGMFGGDRWSVGVNPMTAGFGQLN 235
            :::|  .:::.....::|   .:|..|.    :::|.||      ..:.|..|  |::      .
Zfish   163 RQEKLEVSSIKLQESSML---SIPRSGP----LSLGSGL------PLEPWLTG--PIS------T 206

  Fly   236 QSSPLSSSLNSGLNSGINMGSALGAGSY---QHYGLNALGDSMMYQHSVGGVSCGP 288
            .||||.|     |.|.|....|:.| ||   |....:.|..|:.:   :|.| |.|
Zfish   207 SSSPLQS-----LPSFITPQQAVPA-SYTPPQFLSSSTLNHSLPH---IGAV-CPP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otpNP_001286654.1 Homeodomain 117..168 CDD:459649 31/50 (62%)
rx3NP_571302.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Octapeptide motif 32..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..72
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..107 3/8 (38%)
Homeodomain 107..163 CDD:459649 36/55 (65%)
OAR 268..284 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 272..285
Nuclear localization signal. /evidence=ECO:0000255 278..282
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.