DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otp and Otp

DIOPT Version :9

Sequence 1:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_035151.1 Gene:Otp / 18420 MGIID:99835 Length:325 Species:Mus musculus


Alignment Length:373 Identity:142/373 - (38%)
Similarity:165/373 - (44%) Gaps:121/373 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GGGSSGGVPVGGGVARLHISGGLCDNSNALNGGN---GSSGNGNGN----------------NNN 95
            ||...||.|           |.|..||:.:.|..   |......|:                ...
Mouse    34 GGSDPGGHP-----------GDLAPNSDPVEGATLLPGEDITTVGSTPASLAVSAKDPDKQPGPQ 87

  Fly    96 GNGNNNNSMQQQDQHLDKNKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRV 160
            |..|.:.:.|||.|    .|||||||||||||||||||.|:||||||||||||:|:|||||||||
Mouse    88 GGPNPSQAGQQQGQ----QKQKRHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRV 148

  Fly   161 QVWFQNRRAKWKKRKKTTNVFRTPGALLPSHGLP--PFGANITNIAMGDGLCGTGMFGGD-RWSV 222
            ||||||||||||||||||||||.||.|||:.|||  |..|.....||||.||  .....| ||:.
Mouse   149 QVWFQNRRAKWKKRKKTTNVFRAPGTLLPTPGLPQFPSAAAAAAAAMGDSLC--SFHANDTRWAA 211

  Fly   223 GVNPMTAGFGQLNQSSPLSSSLNSGLNSGINMGSALGAGSYQHYGLNALGDSMMYQHSVGGVSCG 287
            ...|   |..||    ||..:|                |..|     |:..|             
Mouse   212 AAMP---GVSQL----PLPPAL----------------GRQQ-----AMAQS------------- 235

  Fly   288 PSGSPSATTPPNMNSCS-SVTPPPLSAQPNSSQNELNGEPMPLHQQQQQQTHQHQQQQTHQHHPM 351
                        ::.|| :..|||.|...::|....||..:                |:|.:.|.
Mouse   236 ------------LSQCSLAAGPPPNSMGLSNSLAGSNGAGL----------------QSHLYQPA 272

  Fly   352 AP-------PTPTQQQQQLPQSMQSP--SDGANDTLHSIAALRRRASE 390
            .|       |.|:..... ||...||  ||....|  |||:|||:|.|
Mouse   273 FPGMVPASLPGPSNVSGS-PQLCSSPDSSDVWRGT--SIASLRRKALE 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otpNP_001286654.1 Homeobox 119..167 CDD:278475 43/47 (91%)
OtpNP_035151.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..112 26/92 (28%)
Homeobox 107..156 CDD:395001 44/48 (92%)
OAR 303..320 CDD:397759 9/17 (53%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319 9/14 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5965
eggNOG 1 0.900 - - E33208_3BA7E
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007109
OrthoInspector 1 1.000 - - oto95379
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46770
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4709
SonicParanoid 1 1.000 - - X5198
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.900

Return to query results.
Submit another query.