Sequence 1: | NP_001286654.1 | Gene: | otp / 37364 | FlyBaseID: | FBgn0015524 | Length: | 416 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_000545.1 | Gene: | CRX / 1406 | HGNCID: | 2383 | Length: | 299 | Species: | Homo sapiens |
Alignment Length: | 265 | Identity: | 73/265 - (27%) |
---|---|---|---|
Similarity: | 105/265 - (39%) | Gaps: | 88/265 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 115 KQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKK--- 176
Fly 177 -------------------------TTNVFRTPGALLPSHGLP---PFGANITNIAMGDGLCGTG 213
Fly 214 MFGGDRWSVGVNPMTAGFGQLNQSSPLSSSLNSGL-NSGINM------------------GSALG 259
Fly 260 AGSYQHYGLNALGDSMMYQHSVGGVSCGPSGSPSATTPPNMNSCSSVTPPPLSAQPNSSQNELNG 324
Fly 325 EPMPL 329 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
otp | NP_001286654.1 | Homeobox | 119..167 | CDD:278475 | 29/47 (62%) |
CRX | NP_000545.1 | Homeobox | 43..93 | CDD:395001 | 32/49 (65%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 93..155 | 8/61 (13%) | |||
TF_Otx | 166..249 | CDD:397546 | 22/97 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 100 | 1.000 | Inparanoid score | I5000 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |