DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otp and CRX

DIOPT Version :9

Sequence 1:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_000545.1 Gene:CRX / 1406 HGNCID:2383 Length:299 Species:Homo sapiens


Alignment Length:265 Identity:73/265 - (27%)
Similarity:105/265 - (39%) Gaps:88/265 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 KQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKK--- 176
            ||:|.||.||.:||.|||..|:||.|||::.|||:|::|.|.||||||||:|||||.:::::   
Human    38 KQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCRQQRQQQK 102

  Fly   177 -------------------------TTNVFRTPGALLPSHGLP---PFGANITNIAMGDGLCGTG 213
                                     :|:|...|..:..|:..|   |.|:..|.:|         
Human   103 QQQQPPGGQAKARPAKRKAGTSPRPSTDVCPDPLGISDSYSPPLPGPSGSPTTAVA--------- 158

  Fly   214 MFGGDRWSVGVNPMTAGFGQLNQSSPLSSSLNSGL-NSGINM------------------GSALG 259
                          |.........|||..:..:|| .||.::                  .||.|
Human   159 --------------TVSIWSPASESPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYG 209

  Fly   260 AGSYQHYGLNALGDSMMYQHSVGGVSCGPSGSPSATTPPNMNSCSSVTPPPLSAQPNSSQNELNG 324
            :.|....||:.....|:.|  :||.:..|...||             ..|.|:..|.|...:..|
Human   210 SPSSYFSGLDPYLSPMVPQ--LGGPALSPLSGPS-------------VGPSLAQSPTSLSGQSYG 259

  Fly   325 EPMPL 329
            ...|:
Human   260 AYSPV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otpNP_001286654.1 Homeobox 119..167 CDD:278475 29/47 (62%)
CRXNP_000545.1 Homeobox 43..93 CDD:395001 32/49 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..155 8/61 (13%)
TF_Otx 166..249 CDD:397546 22/97 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I5000
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.