DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otp and Pitx1

DIOPT Version :9

Sequence 1:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_446076.1 Gene:Pitx1 / 113983 RGDID:69253 Length:315 Species:Rattus norvegicus


Alignment Length:257 Identity:84/257 - (32%)
Similarity:125/257 - (48%) Gaps:48/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 NGGNGSSGNGNGNNNNGNGNNNNSMQQQDQHLDKNKQKRHRTRFTPAQLNELERCFSKTHYPDIF 144
            :||.||:|.|:.                :....|.||:|.||.||..||.|||..|.:..|||:.
  Rat    69 DGGAGSAGCGSA----------------EDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMS 117

  Fly   145 MREEIAMRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRTPGALLPSHG--LPPFGANITNIAMGD 207
            ||||||:...|||.||:|||:||||||:||::...:....|..:|...  :.|:          :
  Rat   118 MREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPY----------E 172

  Fly   208 GLCGTGMFGGDRW---SVGVNPM-TAGFGQLNQSSPLSS----SLNSGLNSGINMGSALGAGS-- 262
            .:.....:..:.|   |:...|: |..|...|..|||||    |..|.::| :.|.|::|.||  
  Rat   173 DVYAAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISS-MTMPSSMGPGSVP 236

  Fly   263 -YQHYGLNAL----GDSMMYQHSVGGVSCGPSGSPSATTPPNMNSC-SSVTPPPLSAQPNSS 318
             ..:.|||.:    |.|:....|.|  :| |.|:|::......::| ||:....|.::.:||
  Rat   237 GMPNSGLNNINNLTGSSLNSAMSPG--AC-PYGTPASPYSVYRDTCNSSLASLRLKSKQHSS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otpNP_001286654.1 Homeobox 119..167 CDD:278475 27/47 (57%)
Pitx1NP_446076.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..103 16/49 (33%)
Homeobox 93..146 CDD:395001 33/52 (63%)
Interaction with PIT-1. /evidence=ECO:0000250 149..280 33/144 (23%)
OAR 277..294 CDD:397759 4/16 (25%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 281..294 3/12 (25%)
Nuclear localization signal. /evidence=ECO:0000255 287..291 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I4895
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.