DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and CBL8

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001319319.1 Gene:CBL8 / 842756 AraportID:AT1G64480 Length:214 Species:Arabidopsis thaliana


Alignment Length:174 Identity:47/174 - (27%)
Similarity:76/174 - (43%) Gaps:25/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKMPEL--------RENPFRRRI 76
            |.||..||..:|..|::|...::    .:|          .|.|...|        .:|.|..|:
plant    29 TPFTVNEIEALHDLFKKLSTSII----NDG----------LIHKEEFLLALFRNGSMQNLFADRV 79

  Fly    77 CEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADL---MSCLTTMT 138
            ...|.|...|.:.|.:|:.:||:|....|...|..:.||::|....|||...:|   :..|...|
plant    80 FYMFDRKRNGVIEFGEFVRSLSIFHPYTPEHEKSAFMFKLFDLHGTGFIEPHELKKMVGALLGET 144

  Fly   139 KNELSPEEHQQIADKVIEEADVDGDGKLSILEFEHVILRAPDFL 182
            ..|||.|..:.|.::.:.|.|.:.|||:...|::.::.:.|..|
plant   145 DLELSEESIEAIVEQTMLEVDTNKDGKIDEEEWKELVAKNPSIL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 45/170 (26%)
CBL8NP_001319319.1 FRQ1 29..187 CDD:227455 46/171 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.