DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and CBL2

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001332655.1 Gene:CBL2 / 835697 AraportID:AT5G55990 Length:226 Species:Arabidopsis thaliana


Alignment Length:175 Identity:49/175 - (28%)
Similarity:87/175 - (49%) Gaps:15/175 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TFFTRKEILRVHKRFRELRPDLVPRQM---TEGQASSVKVPCECIEKMPELRENPFRRRICEAFS 81
            |.|:..||..:::.|:::...::...:   .|.|.:..|.         ..:|:.|..|:.:.|.
plant    40 TVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKT---------NKKESLFADRVFDLFD 95

  Fly    82 RDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADL-MSCLTTMTKNELSPE 145
            ....|.|.||:|..|||||...||.|.|:.::|::||..|.|||...:: ...:.|:.::.::.:
plant    96 TKHNGILGFEEFARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLK 160

  Fly   146 EH--QQIADKVIEEADVDGDGKLSILEFEHVILRAPDFLSTFHIR 188
            :.  :.|.||..||||...|||:...|:..::||.|..|....::
plant   161 DTVIEDIIDKTFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 47/165 (28%)
CBL2NP_001332655.1 FRQ1 36..198 CDD:227455 48/166 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4251
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.