DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and CBL9

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_199521.1 Gene:CBL9 / 834756 AraportID:AT5G47100 Length:213 Species:Arabidopsis thaliana


Alignment Length:184 Identity:47/184 - (25%)
Similarity:89/184 - (48%) Gaps:21/184 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QELDDYQDC------TFFTRKEILRVHKRFRELRPDLVPRQM---TEGQASSVKVPCECIEKMPE 66
            :|..|:::.      |.|:..|:..:::.|:.:...:|...:   .|.|.:..|         ..
plant    10 REFPDHENPVKLASETAFSVSEVEALYELFKSISSSVVDDGLINKEEFQLALFK---------NR 65

  Fly    67 LRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADLM 131
            .:||.|..||.:.|....:|.:.|.||:.:|:||...|..:.|..:.|::||.|..|||...::.
plant    66 KKENLFANRIFDLFDVKRKGVIDFGDFVRSLNVFHPNASLEEKTDFTFRLYDMDCTGFIERQEVK 130

  Fly   132 SCLTTM---TKNELSPEEHQQIADKVIEEADVDGDGKLSILEFEHVILRAPDFL 182
            ..|..:   ::.:|:.:..:.|.|:..|:||||.|||:...|:.:.:::.|..|
plant   131 QMLIALLCESEMKLADDTIEMILDQTFEDADVDRDGKIDKTEWSNFVIKNPSLL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 43/165 (26%)
CBL9NP_199521.1 FRQ1 25..183 CDD:227455 44/166 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.