DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and AT5G17470

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_197249.1 Gene:AT5G17470 / 831613 AraportID:AT5G17470 Length:146 Species:Arabidopsis thaliana


Alignment Length:106 Identity:34/106 - (32%)
Similarity:56/106 - (52%) Gaps:12/106 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 ICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADLMSCLTTMTKN 140
            |.|...::..|.:|:::|.:|:..||.....: ::...|:..|.|.|..|..|:..|||.     
plant     6 IFERVDKNKDGKISWDEFAEAIRAFSPSITSE-EIDNMFREIDVDGDNQIDVAEYASCLM----- 64

  Fly   141 ELSPEEHQQIADKVIEEA----DVDGDGKLSILEFEHVILR 177
             |..|.:::..|.|::||    |:|||||:|..|. ||:|:
plant    65 -LGGEGNKEDEDIVMKEAFDLYDIDGDGKISASEI-HVVLK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 34/106 (32%)
AT5G17470NP_197249.1 EF-hand_7 5..60 CDD:290234 14/54 (26%)
EFh 5..58 CDD:238008 13/52 (25%)
EF-hand_7 78..138 CDD:290234 13/27 (48%)
EFh 79..139 CDD:238008 13/26 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.