DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and CBL10

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_195026.1 Gene:CBL10 / 829437 AraportID:AT4G33000 Length:256 Species:Arabidopsis thaliana


Alignment Length:144 Identity:47/144 - (32%)
Similarity:67/144 - (46%) Gaps:16/144 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KVPCECIE----KMPELR---------ENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPR 106
            |:.|..|:    ...|||         ||.|..|:.:.|.....|.:.||:|:.|||||...|..
plant    87 KLSCSIIDDGLIHKEELRLALFQAPYGENLFLDRVFDLFDEKKNGVIEFEEFIHALSVFHPYASI 151

  Fly   107 DIKVFYAFKIYDFDQDGFIGHAD---LMSCLTTMTKNELSPEEHQQIADKVIEEADVDGDGKLSI 168
            ..|..:||::||..|.|||...:   ::|.:...:...||.|....|.||...:||.|.|||:|.
plant   152 QEKTDFAFRLYDLRQTGFIEREEVQQMVSAILLESDMMLSDELLTMIIDKTFADADSDKDGKISK 216

  Fly   169 LEFEHVILRAPDFL 182
            .|:...:.:.|..|
plant   217 DEWNVYVHKHPSLL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 45/140 (32%)
CBL10NP_195026.1 EF-hand_7 81..142 CDD:290234 15/54 (28%)
EFh 118..180 CDD:238008 21/61 (34%)
EF-hand_7 118..179 CDD:290234 21/60 (35%)
EFh 154..219 CDD:238008 23/64 (36%)
EF-hand_7 158..218 CDD:290234 22/59 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4251
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.