DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and CBL6

DIOPT Version :10

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_567492.1 Gene:CBL6 / 827330 AraportID:AT4G16350 Length:226 Species:Arabidopsis thaliana


Alignment Length:173 Identity:48/173 - (27%)
Similarity:86/173 - (49%) Gaps:15/173 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TFFTRKEILRVHKRFREL-RPDLVPRQMTEGQASSVKVPCECIEKMPELRENPFRRRICEAFSRD 83
            |.||..||..:::.|:.: :..|:.::..:          ..:.||...| :.|..|:.:.|...
plant    38 TVFTVNEIEALYELFKSISKNGLIDKEQFQ----------LVLFKMNTTR-SLFADRVFDLFDTK 91

  Fly    84 GQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADLMSCLT-TMTKNELSPEEH 147
            ..|.|.||.|..:||||...|..:.|:.::||:||.:|.|:|...::...:. |:.::.::..:|
plant    92 NTGILDFEAFARSLSVFHPNAKFEDKIEFSFKLYDLNQQGYIKRQEVKQMVVRTLAESGMNLSDH 156

  Fly   148 --QQIADKVIEEADVDGDGKLSILEFEHVILRAPDFLSTFHIR 188
              :.|.||..||||...|||:...|:..::||.|..|....::
plant   157 VIESIIDKTFEEADTKLDGKIDKEEWRSLVLRHPSLLQNMSLQ 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 EFh 109..171 CDD:238008 20/64 (31%)
CBL6NP_567492.1 PTZ00183 44..190 CDD:185503 43/156 (28%)

Return to query results.
Submit another query.