DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and CBL5

DIOPT Version :10

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_192051.2 Gene:CBL5 / 826671 AraportID:AT4G01420 Length:203 Species:Arabidopsis thaliana


Alignment Length:178 Identity:43/178 - (24%)
Similarity:71/178 - (39%) Gaps:39/178 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKMPELRENPFR----------- 73
            |||:..|:..:|..|.:|                    ..|:.....|.:..|:           
plant    24 TFFSEAEVEVLHGLFIKL--------------------TSCLSNDNLLTKEKFQFILIKNTKKRS 68

  Fly    74 ---RRICEAFSRDGQGNLSFEDFLDALSVF-SEQAPRDIKVFYAFKIYDFDQDGFIGHADLMS-C 133
               .||...|.....|.:.|.:|:..|::| ...:||| |..:||::||..:.|||...::.. .
plant    69 LSAERIFGLFDMRNDGAIDFGEFVHTLNIFHPNSSPRD-KAIFAFRLYDTRETGFIEPEEVKEMI 132

  Fly   134 LTTMTKNELSPEEH--QQIADKVIEEADVDGDGKLSILEFEHVILRAP 179
            :..:.::||...|.  ..|..|..||||...||.:.:.|:|:.:...|
plant   133 IDVLEESELMLSESIIDSIVSKTFEEADWKKDGIIDLEEWENFVATYP 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 EFh 109..171 CDD:238008 19/64 (30%)
CBL5NP_192051.2 FRQ1 <71..134 CDD:444056 19/63 (30%)
EFh 107..172 CDD:238008 19/64 (30%)

Return to query results.
Submit another query.