DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and Kcnip2

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_006527533.1 Gene:Kcnip2 / 80906 MGIID:2135916 Length:286 Species:Mus musculus


Alignment Length:169 Identity:44/169 - (26%)
Similarity:78/169 - (46%) Gaps:22/169 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKMPELRENPFRRRIC 77
            |:..|:.|.|||:|:..:::.|:...|..:..:....|..|        :..|:...:.:...:.
Mouse   109 LEQLQEQTKFTRRELQVLYRGFKNECPSGIVNEENFKQIYS--------QFFPQGDSSNYATFLF 165

  Fly    78 EAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHA----------DLMS 132
            .||..:..|::|||||:..|||.. :...|.::.:||.:||.::||.|...          |:|.
Mouse   166 NAFDTNHDGSVSFEDFVAGLSVIL-RGTIDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMG 229

  Fly   133 CLTTMTKNELSPEEHQQIADKVIEEADVDGDGKLSILEF 171
            ..|.....|.:|.||   .:...::.|.:.||.::|.||
Mouse   230 KYTYPALREEAPREH---VESFFQKMDRNKDGVVTIEEF 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 42/162 (26%)
Kcnip2XP_006527533.1 FRQ1 109..275 CDD:227455 44/169 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.