DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and rcvrnb

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001304684.1 Gene:rcvrnb / 792903 ZFINID:ZDB-GENE-120815-1 Length:203 Species:Danio rerio


Alignment Length:196 Identity:38/196 - (19%)
Similarity:87/196 - (44%) Gaps:34/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGN-KVVTFTEQELDDYQDCTFFTRKEILRVHKRF-RELRPDLVPRQMTEGQASSVKVPCECIEK 63
            ||| :....:...|.:.|..|.::::::...:::| .|.....:.|:..:...:|.         
Zfish     1 MGNSRSSALSRDVLQELQTSTTYSQEQLFSWYQKFLNECPTGRISREQFQSIYASF--------- 56

  Fly    64 MPELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIG-- 126
            .|:.....:.:.:..:|..|..|.|.|::::.||.:.|.....: |:.:||.:||.|::|.|.  
Zfish    57 FPDADPGAYAQHVFRSFDADSDGTLDFKEYIVALHLTSSGKTVE-KLEWAFALYDVDRNGSITKN 120

  Fly   127 --HADLMSCLTTMTK--------NELSPEEHQQIADKVIEEADVDGDGKLS-------ILEFEHV 174
              |..:.|....::|        :|.:||:.   .||:.:......:||::       :::.:|:
Zfish   121 EIHEIVKSIFNMISKEDQKNLPDDENTPEKR---TDKIWDFFGKKENGKITEGEFIQGVMDNKHI 182

  Fly   175 I 175
            :
Zfish   183 L 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 33/176 (19%)
rcvrnbNP_001304684.1 FRQ1 10..182 CDD:227455 34/184 (18%)
EFh 65..127 CDD:238008 17/62 (27%)
EFh 101..177 CDD:238008 18/78 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.