Sequence 1: | NP_611523.3 | Gene: | Cib2 / 37363 | FlyBaseID: | FBgn0034558 | Length: | 189 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001304684.1 | Gene: | rcvrnb / 792903 | ZFINID: | ZDB-GENE-120815-1 | Length: | 203 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 38/196 - (19%) |
---|---|---|---|
Similarity: | 87/196 - (44%) | Gaps: | 34/196 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MGN-KVVTFTEQELDDYQDCTFFTRKEILRVHKRF-RELRPDLVPRQMTEGQASSVKVPCECIEK 63
Fly 64 MPELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIG-- 126
Fly 127 --HADLMSCLTTMTK--------NELSPEEHQQIADKVIEEADVDGDGKLS-------ILEFEHV 174
Fly 175 I 175 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cib2 | NP_611523.3 | FRQ1 | 20..180 | CDD:227455 | 33/176 (19%) |
rcvrnb | NP_001304684.1 | FRQ1 | 10..182 | CDD:227455 | 34/184 (18%) |
EFh | 65..127 | CDD:238008 | 17/62 (27%) | ||
EFh | 101..177 | CDD:238008 | 18/78 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1271942at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X31 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |