DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and cib2

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001072810.1 Gene:cib2 / 780271 XenbaseID:XB-GENE-985356 Length:187 Species:Xenopus tropicalis


Alignment Length:189 Identity:112/189 - (59%)
Similarity:140/189 - (74%) Gaps:2/189 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKVVTFTEQELDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKMP 65
            ||||...||:::||.||||||||||||||:|.||.||.|::||...|:.  ..||:|.:.|..||
 Frog     1 MGNKQTIFTDEQLDAYQDCTFFTRKEILRLHGRFYELAPNIVPMDYTDD--PDVKLPMQLIINMP 63

  Fly    66 ELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADL 130
            ||.||||:.||.::||.||:|||||.||:|..||.||.|||::|..||||||||:.|.||..:||
 Frog    64 ELVENPFKERIVQSFSEDGEGNLSFNDFVDMFSVMSEMAPRELKAIYAFKIYDFNTDNFICKSDL 128

  Fly   131 MSCLTTMTKNELSPEEHQQIADKVIEEADVDGDGKLSILEFEHVILRAPDFLSTFHIRI 189
            ...|..:|:.||..||...:.:|||||||:||||||:..:||::|.:||||||||||||
 Frog   129 EKTLNKLTREELEEEEVNLVCEKVIEEADMDGDGKLAFADFENMISKAPDFLSTFHIRI 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 89/159 (56%)
cib2NP_001072810.1 FRQ1 20..178 CDD:227455 89/159 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I5028
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4653
Inparanoid 1 1.050 229 1.000 Inparanoid score I3375
OMA 1 1.010 - - QHG52608
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0002598
OrthoInspector 1 1.000 - - otm47743
Panther 1 1.100 - - O PTHR45791
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4133
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.