DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and Chp2

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_081639.1 Gene:Chp2 / 70261 MGIID:1917511 Length:196 Species:Mus musculus


Alignment Length:168 Identity:50/168 - (29%)
Similarity:84/168 - (50%) Gaps:27/168 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKMPELRENPFRRRICEAFSRDG 84
            |.|::..:||::.||:.|..|      .:|..|.:.     ::::..|..||...||.::|..:|
Mouse    21 TGFSQASLLRLYHRFQALDRD------EKGFLSRLD-----LQQIGALAVNPLGDRIIDSFFPNG 74

  Fly    85 QGNLSFEDFLDALSVF----SEQA-------PRDI-----KVFYAFKIYDFDQDGFIGHADLMSC 133
            ...|.|..|...|:.|    .|.|       |..:     |:.:||::||.|:||.|...:::..
Mouse    75 SQRLYFAGFARVLAYFRPIDEEDATLRDPKQPEPLNSRMNKLRFAFQLYDLDRDGKISRNEMLQV 139

  Fly   134 LTTMTKNELSPEEHQQIADKVIEEADVDGDGKLSILEF 171
            |..|...:::.|:.:.|.|:.::|||.||||.:|.|||
Mouse   140 LRLMVGVQVTDEQLESITDRTVQEADEDGDGAVSFLEF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 50/168 (30%)
Chp2NP_081639.1 FRQ1 23..179 CDD:227455 49/166 (30%)
Nuclear export signal. /evidence=ECO:0000250 137..148 2/10 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846972
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.