DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and Kcnip3

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_017447516.1 Gene:Kcnip3 / 65199 RGDID:70888 Length:290 Species:Rattus norvegicus


Alignment Length:195 Identity:45/195 - (23%)
Similarity:85/195 - (43%) Gaps:42/195 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LDDYQDCTFFTRKEILRVHKRFRELRP---------DLVPRQ-MTEGQASSVKVPCECIEKMPEL 67
            ||..|..|.||:||:..:::.|:...|         .|:..| ..:|.|::              
  Rat   113 LDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYSQFFPQGDATT-------------- 163

  Fly    68 RENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADLMS 132
                :...:..||..||.|.:.||||:..||:.......: |:.:||.:||.::||:|...::::
  Rat   164 ----YAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHE-KLKWAFNLYDINKDGYITKEEMLA 223

  Fly   133 CL----------TTMTKNELSPEEHQQIADKVIEEADVDGDGKLSILEFEHVILRAPDFLSTFHI 187
            .:          |.....|.:|.||   .::..::.|.:.||.::|.||.....:..:.:|:..:
  Rat   224 IMKSIYDMMGRHTYPILREDAPLEH---VERFFQKMDRNQDGVVTIDEFLETCQKDENIMSSMQL 285

  Fly   188  187
              Rat   286  285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 41/179 (23%)
Kcnip3XP_017447516.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.