DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and Chp1

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_077053.1 Gene:Chp1 / 64152 RGDID:620447 Length:195 Species:Rattus norvegicus


Alignment Length:191 Identity:56/191 - (29%)
Similarity:96/191 - (50%) Gaps:27/191 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKVVT-FTEQELDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKM 64
            ||::..| ..::||::.:..|.|:..:|.|::.||..|         .:|:..::.  .|..:::
  Rat     1 MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSL---------DKGENGTLS--REDFQRI 54

  Fly    65 PELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVF----SEQAPRDI-----------KVFYAF 114
            |||..||...||..||..:|:..::|..|:..|:.|    ..:..:|:           |:.:||
  Rat    55 PELAINPLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAF 119

  Fly   115 KIYDFDQDGFIGHADLMSCLTTMTKNELSPEEHQQIADKVIEEADVDGDGKLSILEFEHVI 175
            ::||.|:|..|...:|:..|..|....:|.|:...|||:.|:|||.|||..:|..||..|:
  Rat   120 RLYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 51/171 (30%)
Chp1NP_077053.1 FRQ1 1..182 CDD:227455 56/191 (29%)
Necessary for association with microtubule and interaction with GAPDH 2..6 1/3 (33%)
Nuclear export signal 1 138..147 2/8 (25%)
Nuclear export signal 2 176..185 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350455
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.