DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and CHP2

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_071380.1 Gene:CHP2 / 63928 HGNCID:24927 Length:196 Species:Homo sapiens


Alignment Length:168 Identity:53/168 - (31%)
Similarity:85/168 - (50%) Gaps:27/168 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKMPELRENPFRRRICEAFSRDG 84
            |.|::..:||:|.|||.|      .:..:|..|.:.     ::::..|..||...||.|:|..||
Human    21 TGFSQASLLRLHHRFRAL------DRNKKGYLSRMD-----LQQIGALAVNPLGDRIIESFFPDG 74

  Fly    85 QGNLSFEDFLDALSVF--------SEQAP--------RDIKVFYAFKIYDFDQDGFIGHADLMSC 133
            ...:.|..|:..|:.|        ..|.|        |..|:.|||::||.|:||.|...:::..
Human    75 SQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQV 139

  Fly   134 LTTMTKNELSPEEHQQIADKVIEEADVDGDGKLSILEF 171
            |..|...:::.|:.:.|||:.::|||.||||.:|.:||
Human   140 LRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 53/168 (32%)
CHP2NP_071380.1 FRQ1 16..179 CDD:227455 53/168 (32%)
Nuclear export signal 137..148 2/10 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.