DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and RCVRN

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_002894.1 Gene:RCVRN / 5957 HGNCID:9937 Length:200 Species:Homo sapiens


Alignment Length:184 Identity:40/184 - (21%)
Similarity:86/184 - (46%) Gaps:25/184 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGN-KVVTFTEQELDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKM 64
            ||| |....:::.|::.|..|.|:.:|:...::.|.:   |....::|:.|..|:..     :..
Human     1 MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLK---DCPTGRITQQQFQSIYA-----KFF 57

  Fly    65 PELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHAD 129
            |:.....:.:.:..:|..:..|.|.|::::.||.: :.....:.|:.:||.:||.|.:|.|...:
Human    58 PDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHM-TTAGKTNQKLEWAFSLYDVDGNGTISKNE 121

  Fly   130 LMSCLTTMTK------------NELSPEEHQQIADKVIEEADVDGDGKLSILEF 171
            ::..:..:.|            :|.:||:.   |:|:.:....:.|.||:..||
Human   122 VLEIVMAIFKMITPEDVKLLPDDENTPEKR---AEKIWKYFGKNDDDKLTEKEF 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 34/164 (21%)
RCVRNNP_002894.1 FRQ1 14..182 CDD:227455 36/171 (21%)
Interaction with GRK1. /evidence=ECO:0000250|UniProtKB:P21457 189..192
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.