Sequence 1: | NP_611523.3 | Gene: | Cib2 / 37363 | FlyBaseID: | FBgn0034558 | Length: | 189 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_957119.2 | Gene: | rcvrn3 / 572207 | ZFINID: | ZDB-GENE-040426-1661 | Length: | 191 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 38/204 - (18%) |
---|---|---|---|
Similarity: | 90/204 - (44%) | Gaps: | 45/204 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MGNKVVTFTEQE-LDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKM 64
Fly 65 -----PELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGF 124
Fly 125 IGHADLMSC------------LTTMTKNELSPE-------------EHQQIADKVIEEADVDGDG 164
Fly 165 KLSILEFEH 173 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cib2 | NP_611523.3 | FRQ1 | 20..180 | CDD:227455 | 31/184 (17%) |
rcvrn3 | NP_957119.2 | FRQ1 | 16..179 | CDD:227455 | 29/176 (16%) |
EFh | 65..125 | CDD:238008 | 13/60 (22%) | ||
EFh | 101..177 | CDD:298682 | 13/75 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1271942at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X31 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |