DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and rcvrn3

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_957119.2 Gene:rcvrn3 / 572207 ZFINID:ZDB-GENE-040426-1661 Length:191 Species:Danio rerio


Alignment Length:204 Identity:38/204 - (18%)
Similarity:90/204 - (44%) Gaps:45/204 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKVVTFTEQE-LDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKM 64
            |||.......:| |||.:..|.|:..||.:.::.|::             |..:.::..:..|::
Zfish     1 MGNAQSGGIPREILDDLKLTTRFSESEITQWYENFQK-------------QCPTGRITLQQFEEI 52

  Fly    65 -----PELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGF 124
                 |:.....:.:.:..:|..:..|.|.|::::.||.:.| .....:|:.:||.::|.|::|:
Zfish    53 YGKFFPDSDATTYAQHVFRSFDANDDGTLDFKEYVVALHMTS-SGKSTLKLEWAFSLFDVDKNGY 116

  Fly   125 IGHADLMSC------------LTTMTKNELSPE-------------EHQQIADKVIEEADVDGDG 164
            :...:::..            .|::..:|.:||             :::::|:....||....|.
Zfish   117 VTKPEVIELSQAIFKLIPKDKQTSLPNDESTPEKRAEKLWAIFDKKDNERVAEGEFIEAIQSSDD 181

  Fly   165 KLSILEFEH 173
            .|.:::::|
Zfish   182 GLRLIQYDH 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 31/184 (17%)
rcvrn3NP_957119.2 FRQ1 16..179 CDD:227455 29/176 (16%)
EFh 65..125 CDD:238008 13/60 (22%)
EFh 101..177 CDD:298682 13/75 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.