DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and Kcnip2

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_064479.2 Gene:Kcnip2 / 56817 RGDID:70887 Length:270 Species:Rattus norvegicus


Alignment Length:169 Identity:44/169 - (26%)
Similarity:78/169 - (46%) Gaps:22/169 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKMPELRENPFRRRIC 77
            |:..|:.|.|||:|:..:::.|:...|..:..:....|..|        :..|:...:.:...:.
  Rat    93 LEQLQEQTKFTRRELQVLYRGFKNECPSGIVNEENFKQIYS--------QFFPQGDSSNYATFLF 149

  Fly    78 EAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHA----------DLMS 132
            .||..:..|::|||||:..|||.. :...|.::.:||.:||.::||.|...          |:|.
  Rat   150 NAFDTNHDGSVSFEDFVAGLSVIL-RGTIDDRLSWAFNLYDLNKDGCITKEEMLDIMKSIYDMMG 213

  Fly   133 CLTTMTKNELSPEEHQQIADKVIEEADVDGDGKLSILEF 171
            ..|.....|.:|.||   .:...::.|.:.||.::|.||
  Rat   214 KYTYPALREEAPREH---VESFFQKMDRNKDGVVTIEEF 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 42/162 (26%)
Kcnip2NP_064479.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
FRQ1 93..259 CDD:227455 44/169 (26%)
Interaction with KCND2. /evidence=ECO:0000250|UniProtKB:Q8R426 257..270
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.