DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and si:ch211-245j22.3

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001074270.1 Gene:si:ch211-245j22.3 / 563798 ZFINID:ZDB-GENE-050419-38 Length:194 Species:Danio rerio


Alignment Length:167 Identity:37/167 - (22%)
Similarity:68/167 - (40%) Gaps:51/167 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GQASSVKVPC-------------------ECIEKMPELRENPFRRRIC----------------E 78
            ||.::  :||                   ||...:..|.|  |||..|                .
Zfish     2 GQTAT--LPCRKGGTYVIELYEWFRKFLNECPSGLITLHE--FRRHFCNGTVGKESAEYAEQIFR 62

  Fly    79 AFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADL---------MSCL 134
            ....:|.|.:.|.:::.|:|:..|.:..: |:.::||:||.|:||.|..:::         ||..
Zfish    63 TLDNNGDGVVDFREYVTAISMLIEGSTVE-KLRWSFKLYDKDKDGAITRSEMLEIMQAVYKMSVA 126

  Fly   135 TTMTKNELSPEEHQQIADKVIEEADVDGDGKLSILEF 171
            .::||.:  |...::..:::....|.|.:..:|..||
Zfish   127 ASLTKPD--PLTAEECTNRIFVRLDKDNNAIISQDEF 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 37/167 (22%)
si:ch211-245j22.3NP_001074270.1 EF-hand_8 31..78 CDD:290545 9/48 (19%)
EF-hand_7 32..81 CDD:290234 9/50 (18%)
EFh 56..118 CDD:238008 15/62 (24%)
EF-hand_7 57..117 CDD:290234 15/60 (25%)
EFh 92..164 CDD:238008 19/72 (26%)
EF-hand_7 93..163 CDD:290234 18/71 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.