DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and guca1d

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001011661.1 Gene:guca1d / 494573 ZFINID:ZDB-GENE-040724-231 Length:185 Species:Danio rerio


Alignment Length:122 Identity:32/122 - (26%)
Similarity:63/122 - (51%) Gaps:8/122 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADLMSCL 134
            |.:..::...|..|..|.:.|.:::.|:|:.. :...:.|:.:.||::|.|.:|.|...:|.:..
Zfish    51 NSYVDQVFCTFDMDRDGYIDFVEYIAAISLML-KGEINQKLKWYFKLFDQDGNGKIDKDELETIF 114

  Fly   135 TT---MTKN-ELSPEEHQQIADKVIEEADVDGDGKLSILEFEHVILRAPDFLSTFHI 187
            |.   :|:| ::.|||   |...:.|:.||:|:|:|::.||.......|:.:....|
Zfish   115 TAIQDITRNRDIVPEE---IVALIFEKIDVNGEGELTLEEFIEGAKEHPEIMDMLKI 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 30/113 (27%)
guca1dNP_001011661.1 EF-hand_8 28..76 CDD:290545 5/24 (21%)
EFh 53..110 CDD:238008 13/57 (23%)
EF-hand_7 56..114 CDD:290234 14/58 (24%)
EFh 89..157 CDD:238008 23/70 (33%)
EF-hand_7 90..154 CDD:290234 22/66 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.