DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and kcnip1b

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_021334841.1 Gene:kcnip1b / 494089 ZFINID:ZDB-GENE-041212-57 Length:225 Species:Danio rerio


Alignment Length:201 Identity:44/201 - (21%)
Similarity:76/201 - (37%) Gaps:58/201 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TFTEQELDDYQDCTF----------------FTRKEILRVHKRFRELRPDLVPRQMT-------- 47
            |.::.::||..:.|.                |:::|:..:::.|:...|..|..:.|        
Zfish    26 TLSKDKVDDELEMTMVCHRPEGLEQLEAQTNFSKQELQVLYRGFKNECPSGVVNEDTFKHIYAQF 90

  Fly    48 --EGQASSVKVPCECIEKMPELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKV 110
              .|.||:                  :...:..||.....|::.||||:..||.......|| |:
Zfish    91 FPHGDAST------------------YAHYLFHAFDTRNNGSIKFEDFVMGLSTLLRGTVRD-KL 136

  Fly   111 FYAFKIYDFDQDGFIGHA----------DLMSCLTTMTKNELSPEEHQQIADKVIEEADVDGDGK 165
            .:.|.:||.::||||...          |:|...|........|:.|   .|...|:.|.:.||.
Zfish   137 EWTFHLYDINKDGFINKEEMTEIVRAIYDMMGKYTYPALKGDVPKAH---VDAFFEKMDKNKDGV 198

  Fly   166 LSILEF 171
            :::.||
Zfish   199 VTLEEF 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 41/188 (22%)
kcnip1bXP_021334841.1 FRQ1 48..205 CDD:227455 40/179 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.