Sequence 1: | NP_611523.3 | Gene: | Cib2 / 37363 | FlyBaseID: | FBgn0034558 | Length: | 189 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021334841.1 | Gene: | kcnip1b / 494089 | ZFINID: | ZDB-GENE-041212-57 | Length: | 225 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 44/201 - (21%) |
---|---|---|---|
Similarity: | 76/201 - (37%) | Gaps: | 58/201 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 TFTEQELDDYQDCTF----------------FTRKEILRVHKRFRELRPDLVPRQMT-------- 47
Fly 48 --EGQASSVKVPCECIEKMPELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKV 110
Fly 111 FYAFKIYDFDQDGFIGHA----------DLMSCLTTMTKNELSPEEHQQIADKVIEEADVDGDGK 165
Fly 166 LSILEF 171 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cib2 | NP_611523.3 | FRQ1 | 20..180 | CDD:227455 | 41/188 (22%) |
kcnip1b | XP_021334841.1 | FRQ1 | 48..205 | CDD:227455 | 40/179 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1271942at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X31 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |