DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and tesca

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_998493.1 Gene:tesca / 406633 ZFINID:ZDB-GENE-040426-2632 Length:218 Species:Danio rerio


Alignment Length:187 Identity:51/187 - (27%)
Similarity:80/187 - (42%) Gaps:43/187 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QELDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKMPELRENPFRRR 75
            |:..|..|.|.|:.::|.::|.||:.|..|            ...:..|.:|.:..|..||.:|:
Zfish    11 QKYQDLADKTGFSTEQIRKLHSRFQYLTQD------------EDTLRREHLENLTNLALNPIKRQ 63

  Fly    76 ICEAF--SRD-GQG------NLSFEDFLDALSVFSEQAPR----------DIKVFYAFKIYDFDQ 121
            |.|||  .|: ||.      .:.||:|:..||||....||          :.|:.:.|.::|.|.
Zfish    64 IIEAFFDKRNLGQNEKGCLQEIGFEEFVTVLSVFRPTKPRTAEDKKKTIKEEKLRFLFNMHDTDN 128

  Fly   122 DGFIG-------HADLMSCLTTMTKNELSPEEHQQIADKVIEEADVDGDGKLSILEF 171
            ||.|.       ..:|:|...|     :..|..:.|:|..:.|......|::|..||
Zfish   129 DGVITLDEYRRVVEELLSSYET-----IEAETAKAISDAAMLEVASVTVGRMSPDEF 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 48/178 (27%)
tescaNP_998493.1 FRQ1 12..>144 CDD:227455 39/143 (27%)
EF-hand_8 83..144 CDD:290545 16/60 (27%)
EFh 116..185 CDD:298682 18/70 (26%)
EF-hand_7 117..184 CDD:290234 17/69 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.