DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and tescb

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_991256.1 Gene:tescb / 402993 ZFINID:ZDB-GENE-040426-1903 Length:216 Species:Danio rerio


Alignment Length:218 Identity:56/218 - (25%)
Similarity:90/218 - (41%) Gaps:64/218 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DDYQ-----DCTFFTRKEILRVHKRFREL--RPDLVPRQMTEGQASSVKVPCECIEKMPELRENP 71
            ||:|     ..|.|:.::|..:|.||::|  ..|.:.|              :.::.:.:|..||
Zfish     9 DDHQYRTLSQKTGFSLEQIGILHNRFKQLSQNEDTLRR--------------DDLKTIQDLESNP 59

  Fly    72 FRRRICEA------FSRDGQGN---LSFEDFLDALSVFSEQAP------------RDIKVFYAFK 115
            .|.:|.||      |.:|..|:   :.||:||..:|.|  :||            |..|:.:.|.
Zfish    60 IRSQIIEAFFDKRNFQKDATGSVQEIGFEEFLTVMSYF--RAPAHQITEEQREEIRRAKLRFLFN 122

  Fly   116 IYDFDQDGFI-----GHA--DLMSCLTTMTKNELSPEEHQQIADKVIEEADVDGDGKLSILEF-E 172
            ::|.|.||.|     .|.  :|:|     ....|..|..:.|||..:.|......|.::..|| |
Zfish   123 MHDTDNDGTITLEEYRHVVEELLS-----RSGALGRETAKGIADAAMLEVASITVGPMAPDEFYE 182

  Fly   173 HV-------ILRAPDFLSTFHIR 188
            .:       ||:..:..:..|||
Zfish   183 GITFEQFLKILKGVEIETRMHIR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 50/197 (25%)
tescbNP_991256.1 FRQ1 14..>144 CDD:227455 36/145 (25%)
EFh 116..>144 CDD:298682 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.