DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and cib2

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_957000.1 Gene:cib2 / 393679 ZFINID:ZDB-GENE-040426-1663 Length:187 Species:Danio rerio


Alignment Length:189 Identity:117/189 - (61%)
Similarity:137/189 - (72%) Gaps:2/189 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKVVTFTEQELDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKMP 65
            ||||...||:::||.||||||||||||||:|.|:.||.|.|||...|..  ..||||...|..||
Zfish     1 MGNKQTIFTDEQLDAYQDCTFFTRKEILRLHGRYHELAPHLVPMDYTND--PDVKVPLALIVNMP 63

  Fly    66 ELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADL 130
            ||:|||||.||.|:||.||||||||.||:|..||.||.|||::|..||||||||:.|.:|...||
Zfish    64 ELKENPFRNRIVESFSEDGQGNLSFNDFVDMFSVLSEMAPRELKAIYAFKIYDFNVDNYICKEDL 128

  Fly   131 MSCLTTMTKNELSPEEHQQIADKVIEEADVDGDGKLSILEFEHVILRAPDFLSTFHIRI 189
            ...|..:||.||:|||...:.:|.|||||:|||.|||..:||::|.|||||||||||||
Zfish   129 EKTLNKLTKEELTPEEVNLVCEKAIEEADLDGDNKLSFADFENMISRAPDFLSTFHIRI 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 94/159 (59%)
cib2NP_957000.1 EFh 107..174 CDD:238008 35/66 (53%)
EF-hand_7 111..173 CDD:290234 33/61 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592186
Domainoid 1 1.000 138 1.000 Domainoid score I4807
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4653
Inparanoid 1 1.050 235 1.000 Inparanoid score I3370
OMA 1 1.010 - - QHG52608
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0002598
OrthoInspector 1 1.000 - - otm26120
orthoMCL 1 0.900 - - OOG6_106257
Panther 1 1.100 - - O PTHR45791
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4133
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.