DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and Chp2

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_038934165.1 Gene:Chp2 / 308965 RGDID:727796 Length:252 Species:Rattus norvegicus


Alignment Length:176 Identity:47/176 - (26%)
Similarity:87/176 - (49%) Gaps:27/176 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ELDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKMPELRENPFRRRI 76
            ::|..:..|.|::..:||::.||:.|..:      .:|..|.:.     ::::..|..||...||
  Rat    69 DVDQIRRETGFSQASLLRLYHRFQALDRE------EKGFLSRLD-----LQQIGALAVNPLGDRI 122

  Fly    77 CEAFSRDGQGNLSFEDFLDALSVF-----------SEQAPRDI-----KVFYAFKIYDFDQDGFI 125
            .::|..:|...:.|..|...|:.|           ..:.|..:     |:.:||::||.|:||.|
  Rat   123 IDSFFPNGSQRVYFAGFARVLAYFRPIDEDDATLRDPKQPEPLNSRMNKLRFAFQLYDLDRDGKI 187

  Fly   126 GHADLMSCLTTMTKNELSPEEHQQIADKVIEEADVDGDGKLSILEF 171
            ...:::..|..|...:::.|:.:.|.|:.::|||.||||.:|.|||
  Rat   188 SRNEMLQVLRLMVGVQVTDEQLESITDRTVQEADEDGDGAVSFLEF 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 46/168 (27%)
Chp2XP_038934165.1 FRQ1 79..235 CDD:227455 45/166 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350471
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.