DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and Tesc

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_006249488.1 Gene:Tesc / 288689 RGDID:1566317 Length:247 Species:Rattus norvegicus


Alignment Length:228 Identity:58/228 - (25%)
Similarity:93/228 - (40%) Gaps:50/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QELDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVK---VP--------------- 57
            :|:.:.:..|.|:..:|.::|:||::|..|....::...:..||:   ||               
  Rat     9 EEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRLCSSRLCSVRSVSVPPTSQLPLSVKLQWRP 73

  Fly    58 -C--ECIEKMPELRENPFRRRICEAF-----SRDGQGNL----SFEDFLDALSVF--------SE 102
             |  |....:|:|..||.|.:|..||     .|.|...|    :|||||..:|.|        .|
  Rat    74 VCSKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGSSGLADEINFEDFLTIMSYFRPIDTTLGEE 138

  Fly   103 QA--PRDIKVFYAFKIYDFDQDGFIGHADLMSCLTTMTKN--ELSPEEHQQIADKVIEEA----- 158
            |.  .|..|:.:.|.:||.|.||.|...:..:.:..:...  .:..|..:.|||..:.||     
  Rat   139 QVELSRKEKLKFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCV 203

  Fly   159 -DVDGDGKLSILEFEHV--ILRAPDFLSTFHIR 188
             .::.|.....:.||..  |.:..|..:..|||
  Rat   204 GQMEPDQVYEGITFEDFLKIWQGIDIETKMHIR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 53/209 (25%)
TescXP_006249488.1 EFh 147..>175 CDD:298682 8/27 (30%)
EF-hand_7 148..223 CDD:290234 16/74 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350443
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.