DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and Cib3

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_006509731.1 Gene:Cib3 / 234421 MGIID:2685953 Length:187 Species:Mus musculus


Alignment Length:189 Identity:105/189 - (55%)
Similarity:142/189 - (75%) Gaps:2/189 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKVVTFTEQELDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKMP 65
            ||||...|:.::|::||||||||||||:|:..|:::|.|.|||...|  .:..||||.|.|..||
Mouse     1 MGNKQTVFSHEQLEEYQDCTFFTRKEIMRLFYRYQDLAPQLVPLDYT--TSPKVKVPYELIGSMP 63

  Fly    66 ELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADL 130
            ||::||||:||.:.||:||.|:::.|:|||..||.||.||||:|.:||||||||:.|.:|...||
Mouse    64 ELKDNPFRQRIAQVFSQDGDGHMTLENFLDMFSVMSEMAPRDLKAYYAFKIYDFNNDNYICAWDL 128

  Fly   131 MSCLTTMTKNELSPEEHQQIADKVIEEADVDGDGKLSILEFEHVILRAPDFLSTFHIRI 189
            ...:|.:|:.|||.||...:.:||::|||.|.||:||:.:|:::|||||||||||||||
Mouse   129 EQTVTRLTRGELSAEEVTLVCEKVLDEADGDQDGRLSLEDFQNMILRAPDFLSTFHIRI 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 84/159 (53%)
Cib3XP_006509731.1 FRQ1 6..178 CDD:227455 90/173 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846952
Domainoid 1 1.000 72 1.000 Domainoid score I9306
eggNOG 1 0.900 - - E2759_KOG0038
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52608
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0002598
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106257
Panther 1 1.100 - - LDO PTHR45791
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4133
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.750

Return to query results.
Submit another query.